Tirzepatide 30mg
Dual GLP-1/GIP agonist
Overview
Tirzepatide is a dual GIP and GLP-1 receptor agonist studied in metabolic research for its combined incretin activity.
History
Tirzepatide 30mg has been characterized in the peer-reviewed literature over multiple decades of investigation. This section aggregates published citations spanning its identification, structural characterization, and subsequent laboratory research programs. See the References section below for the full bibliography.
Mechanism of action
- Sequence
- YXEGTFTSDYSIYLDKQAAKEFVQWLLAGGPSSGAPPPS
- Molecular Formula
- C225H348N48O68
- Molecular Weight
- 4813.53 g/mol
- CAS Number
- 2023788-19-2
- Appearance
- White lyophilized powder
- Purity
- 99.5% by HPLC
Tirzepatide is a dual GIP and GLP-1 receptor agonist studied in metabolic research for its combined incretin activity.
Published research
Animal studies
Human studies
No human-subject citations catalogued for Tirzepatide 30mg.
Current scientific understanding
The current body of literature on Tirzepatide 30mg continues to evolve. BioNex aggregates published sources for laboratory research reference only; nothing on this page is a medical claim, dosage guidance, or therapeutic recommendation.
References
- Dual GIP/GLP-1 receptor agonism in preclinical models — Coskun T. et al., Mol Metab, 2018 · source
Frequently asked questions
Continue your research
This page aggregates published scientific literature and analytical information for laboratory research reference only. Content is not evaluated by the FDA and does not constitute medical advice, dosage guidance, treatment claims, or administration instructions. Compounds are supplied strictly for in-vitro laboratory research by qualified professionals.