TB-500
Thymosin β4 synthetic fragment
Overview
TB-500 is a synthetic version of the naturally occurring peptide Thymosin Beta-4. It is widely studied for its role in actin sequestration and its influence on cell migration and differentiation in vitro.
History
TB-500 has been characterized in the peer-reviewed literature over multiple decades of investigation. This section aggregates published citations spanning its identification, structural characterization, and subsequent laboratory research programs. See the References section below for the full bibliography.
Mechanism of action
- Sequence
- SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Molecular Formula
- C212H350N56O78S
- Molecular Weight
- 4963.44 g/mol
- CAS Number
- 77591-33-4
- Appearance
- White lyophilized powder
- Purity
- 99.4% by HPLC
TB-500 is a synthetic version of the naturally occurring peptide Thymosin Beta-4. It is widely studied for its role in actin sequestration and its influence on cell migration and differentiation in vitro.
Published research
Animal studies
No preclinical / animal-model citations catalogued for TB-500.
Human studies
No human-subject citations catalogued for TB-500.
Current scientific understanding
The current body of literature on TB-500 continues to evolve. BioNex aggregates published sources for laboratory research reference only; nothing on this page is a medical claim, dosage guidance, or therapeutic recommendation.
References
- Thymosin beta-4 activates integrin-linked kinase — Bock-Marquette I. et al., Nature, 2004 · source
Frequently asked questions
Continue your research
This page aggregates published scientific literature and analytical information for laboratory research reference only. Content is not evaluated by the FDA and does not constitute medical advice, dosage guidance, treatment claims, or administration instructions. Compounds are supplied strictly for in-vitro laboratory research by qualified professionals.