Semaglutide 15mg
GLP-1 receptor agonist
Overview
Semaglutide is a long-acting GLP-1 receptor agonist analog studied extensively in metabolic and endocrine research models.
History
Semaglutide 15mg has been characterized in the peer-reviewed literature over multiple decades of investigation. This section aggregates published citations spanning its identification, structural characterization, and subsequent laboratory research programs. See the References section below for the full bibliography.
Mechanism of action
- Sequence
- HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG
- Molecular Formula
- C187H291N45O59
- Molecular Weight
- 4113.58 g/mol
- CAS Number
- 910463-68-2
- Appearance
- White lyophilized powder
- Purity
- 99.7% by HPLC
Semaglutide is a long-acting GLP-1 receptor agonist analog studied extensively in metabolic and endocrine research models.
Published research
Animal studies
No preclinical / animal-model citations catalogued for Semaglutide 15mg.
Human studies
No human-subject citations catalogued for Semaglutide 15mg.
Current scientific understanding
The current body of literature on Semaglutide 15mg continues to evolve. BioNex aggregates published sources for laboratory research reference only; nothing on this page is a medical claim, dosage guidance, or therapeutic recommendation.
References
- Semaglutide, GLP-1 agonism and metabolic outcomes — Marso S. et al., N Engl J Med, 2016 · source
Frequently asked questions
Continue your research
This page aggregates published scientific literature and analytical information for laboratory research reference only. Content is not evaluated by the FDA and does not constitute medical advice, dosage guidance, treatment claims, or administration instructions. Compounds are supplied strictly for in-vitro laboratory research by qualified professionals.